PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0498s0017.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 443aa    MW: 48262 Da    PI: 7.441
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0498s0017.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.28e-2947103259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK+vkg++f rsYYrCt+++C+vkk+ver++ d++++++   g+H+h+
  Kalax.0498s0017.2.p  47 SDGYSWRKYGQKHVKGNKFVRSYYRCTHPDCQVKKQVERAH-DGQITDTLVFGDHDHP 103
                          7****************************************.***************8 PP

2WRKY106.91e-33221279159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ++Dgy+WrKYGqK vkg+++prsYYrC++agCpvkk+ver+++dpkvv++tYeg+H+h+
  Kalax.0498s0017.2.p 221 VNDGYRWRKYGQKFVKGNPNPRSYYRCSTAGCPVKKHVERASHDPKVVITTYEGQHDHD 279
                          58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081120.19741105IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-2444104IPR003657WRKY domain
SuperFamilySSF1182901.29E-2246104IPR003657WRKY domain
SMARTSM007743.7E-3046104IPR003657WRKY domain
PfamPF031061.8E-2248103IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-36208281IPR003657WRKY domain
SuperFamilySSF1182906.28E-30213281IPR003657WRKY domain
PROSITE profilePS5081136.242216281IPR003657WRKY domain
SMARTSM007746.8E-39221280IPR003657WRKY domain
PfamPF031068.0E-27222278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MVATEESLRG EVASEIEKMN SPETGLLARG FDQEGGTPLV TPEKGPSDGY SWRKYGQKHV  60
KGNKFVRSYY RCTHPDCQVK KQVERAHDGQ ITDTLVFGDH DHPRTQLSLP VTVSCTVVAK  120
EGVMGVPCPV IPEERTPAAP HQTPKPTVDI ATPMPLNVVA SDLSKHAVVQ SIKTKDNVGK  180
DGTPDLKRQK KEPRRPEAVI MDKPTVDPRL VLQTVSEVDM VNDGYRWRKY GQKFVKGNPN  240
PRSYYRCSTA GCPVKKHVER ASHDPKVVIT TYEGQHDHDM PPARMMSNCT SGNSTNQLAL  300
EYNPGVGSDV VDESYQHGKP KDQLNGEQKI ESGEVEKVGN KLVSHSSSGL GSKVSDQISG  360
KSTDNLEAVE SSAVPDVVMA AKSNGRETNK GSKSPGLAAA SLTAEEDKKL RKERIKEEFS  420
EAIHRNSEHG SPTAGSLDES HV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-3647283276WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869324.11e-111PREDICTED: WRKY transcription factor 1-like
RefseqXP_015881045.11e-111PREDICTED: WRKY transcription factor 1
SwissprotQ9SI375e-74WRKY1_ARATH; WRKY transcription factor 1
TrEMBLF6HHL81e-105F6HHL8_VITVI; Putative uncharacterized protein
STRINGVIT_12s0057g00550.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-77zinc-dependent activator protein-1